PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0887s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 346aa    MW: 39109.7 Da    PI: 6.523
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0887s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF63.62.1e-201553745
                         HHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
               SRF-TF  7 snrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                           rq t++kR++gi+KKA+ELS+LCd++v +++fs+tgk
  Cagra.0887s0001.1.p 15 NARQSTYAKRKHGIMKKAKELSILCDIDVVLLMFSPTGK 53
                         579**********************************98 PP

2K-box16.14.6e-071161772479
                K-box  24 LkkeienLq.....reqRhllGedLesL.slkeLqqLeqqLekslkkiRskKnellleqiee 79 
                          L ++ + Lq        R   ++dLe++ +l +LqqLe+ L  sl +i ++K  +   q ++
  Cagra.0887s0001.1.p 116 LSEKFRFLQtqlsdIRTRLSYWNDLENIdNLDDLQQLEHSLRLSLAQISAHKASMPQLQRQQ 177
                          4455555554442322366789999999679*********************9876555544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-26160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.357153IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.41E-23292IPR002100Transcription factor, MADS-box
CDDcd002661.22E-21284No hitNo description
PRINTSPR004041.1E-14323IPR002100Transcription factor, MADS-box
PfamPF003191.5E-171454IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-142338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-143859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGRVKLKIKK LQSINARQST YAKRKHGIMK KAKELSILCD IDVVLLMFSP TGKASLCIGK  60
HSIGEVIAKF AQVIPQERTK RKLDSLEALR KMFVKIDHDV DISGFLDRST PAVEVLSEKF  120
RFLQTQLSDI RTRLSYWNDL ENIDNLDDLQ QLEHSLRLSL AQISAHKASM PQLQRQQLMF  180
SECKNETEID IDFGMEMEQQ LENFSWVGTD GNMNVPIKEE DPNLKLHQMY RDVTCSASSS  240
LGNYTGLFSK SSDYISAPKL EPGSIPGISA DPNVQFSSLS FLNDQKLQQL AEWNLLGSPA  300
DYYVSQILEA SYKPQLGGNN WASSDTLPYV SVFDDPLYFR PKLEK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1150130.0AB115013.1 Arabidopsis thaliana At1g69540 mRNA for MADS-box protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006300453.10.0hypothetical protein CARUB_v10020210mg, partial
SwissprotQ1PFA44e-78AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLR0GCL80.0R0GCL8_9BRAS; Uncharacterized protein (Fragment)
STRINGAl_scaffold_0002_16150.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM149561620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69540.10.0AGAMOUS-like 94